Paralogue Annotation for RYR1 residue 952

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 952
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 952

No paralogue variants have been mapped to residue 952 for RYR1.



RYR1QMSGETLKTLLALGCHVGMADEKAEDNLKK>T<KLPKTYMMSNGYKPAPLDLSHVRLTPAQTT982
RYR2QMSLETLKTLLALGCHVGISDEHAEDKVKK>M<KLPKNYQLTSGYKPAPMDLSFIKLTPSQEA994
RYR3QMSTETLKTLLALGCHIAHVNPAAEEDLKK>V<KLPKNYMMSNGYKPAPLDLSDVKLLPPQEI981
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T952Sc.2854A>T Putative BenignSIFT: tolerated
Polyphen: possibly damaging