Paralogue Annotation for RYR1 residue 957

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 957
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 957

No paralogue variants have been mapped to residue 957 for RYR1.



RYR1TLKTLLALGCHVGMADEKAEDNLKKTKLPK>T<YMMSNGYKPAPLDLSHVRLTPAQTTLVDRL987
RYR2TLKTLLALGCHVGISDEHAEDKVKKMKLPK>N<YQLTSGYKPAPMDLSFIKLTPSQEAMVDKL999
RYR3TLKTLLALGCHIAHVNPAAEEDLKKVKLPK>N<YMMSNGYKPAPLDLSDVKLLPPQEILVDKL986
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T957Mc.2870C>T Putative BenignSIFT:
Polyphen: probably damaging