Paralogue Annotation for RYR1 residue 981

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 981
Reference Amino Acid: T - Threonine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 981

No paralogue variants have been mapped to residue 981 for RYR1.



RYR1KTKLPKTYMMSNGYKPAPLDLSHVRLTPAQ>T<TLVDRLAENGHNVWARDRVGQGWSYSAVQD1011
RYR2KMKLPKNYQLTSGYKPAPMDLSFIKLTPSQ>E<AMVDKLAENAHNVWARDRIRQGWTYGIQQD1023
RYR3KVKLPKNYMMSNGYKPAPLDLSDVKLLPPQ>E<ILVDKLAENAHNVWAKDRIKQGWTYGIQQD1010
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T981Kc.2942C>A Putative BenignSIFT: tolerated
Polyphen: benign