Paralogue Annotation for RYR1 residue 999

Residue details

Gene: RYR1
Reference Sequences: Ensembl variant: ENST00000359596 / ENSP00000352608
Amino Acid Position: 999
Reference Amino Acid: R - Arginine
Protein Domain:


Paralogue Variants mapped to RYR1 residue 999

No paralogue variants have been mapped to residue 999 for RYR1.



RYR1LDLSHVRLTPAQTTLVDRLAENGHNVWARD>R<VGQGWSYSAVQDIPARRNPRLVPYRLLDEA1029
RYR2MDLSFIKLTPSQEAMVDKLAENAHNVWARD>R<IRQGWTYGIQQDVKNRRNPRLVPYTLLDDR1041
RYR3LDLSDVKLLPPQEILVDKLAENAHNVWAKD>R<IKQGWTYGIQQDLKNKRNPRLVPYALLDER1028
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR1

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R999Cc.2995C>T Putative BenignSIFT:
Polyphen: probably damaging
p.R999Hc.2996G>A Putative BenignSIFT:
Polyphen: probably damaging