Paralogue Annotation for RYR2 residue 1102

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1102
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1102

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1Y1088CSamaritan myopathyHigh9 22752422

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2AARAEVCSGTGERFRIFRAEKTYAVKAGRW>Y<FEFETVTAGDMRVGWSRPGCQPDQELGSDE1132
RYR1-SQVEN-QSRCDRVRIFRAEKSYTVQSGRW>Y<FEFEAVTTGEMRVGWARPELRPDVELGADE1118
RYR3-ADSAVEKVSIDKIRFFRVERSYAVRSGKW>Y<FEFEVVTGGDMRVGWARPGCRPDVELGADD1118
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 1102 for RYR2.