Paralogue Annotation for RYR2 residue 1220

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1220
Reference Amino Acid: D - Aspartate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1220

No paralogue variants have been mapped to residue 1220 for RYR2.



RYR2LAFKDFDVGDGFIPVCSLGVAQVGRMNFGK>D<VSTLKYFTICGLQEGYEPFAVNTNRDITMW1250
RYR1TAFREIEIGDGFLPVCSLGPGQVGHLNLGQ>D<VSSLRFFAICGLQEGFEPFAINMQRPVTTW1236
RYR3LAFADYEIENGFVPICCLGLSQIGRMNLGT>D<ASTFKFYTMCGLQEGFEPFAVNMNRDVAMW1236
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1220Yc.3658G>T Putative BenignSIFT:
Polyphen: possibly damaging