Paralogue Annotation for RYR2 residue 1226

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1226
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1226

No paralogue variants have been mapped to residue 1226 for RYR2.



RYR2DVGDGFIPVCSLGVAQVGRMNFGKDVSTLK>Y<FTICGLQEGYEPFAVNTNRDITMWLSKRLP1256
RYR1EIGDGFLPVCSLGPGQVGHLNLGQDVSSLR>F<FAICGLQEGFEPFAINMQRPVTTWFSKGLP1242
RYR3EIENGFVPICCLGLSQIGRMNLGTDASTFK>F<YTMCGLQEGFEPFAVNMNRDVAMWFSKRLP1242
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y1226Cc.3677A>G Putative BenignSIFT: deleterious
Polyphen: possibly damaging