Paralogue Annotation for RYR2 residue 1333

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1333
Reference Amino Acid: D - Aspartate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1333

No paralogue variants have been mapped to residue 1333 for RYR2.



RYR2SMPIECAEVFSKTV-AGGLPGAGLFGPK-N>D<LEDYDADSDFEVLMKTAHGHLVPDRVDKDK1363
RYR1SLPVQFHQHFRCTAGATPLAPPGLQPPAED>E<ARAAEPDPDYENLRRSAGGWSEAENGKEGT1351
RYR3SMPVECHSSFSH------------------>-<------------------------------1302
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D1333Nc.3997G>A Putative BenignSIFT: tolerated
Polyphen: benign