Paralogue Annotation for RYR2 residue 1341

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1341
Reference Amino Acid: S - Serine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1341

No paralogue variants have been mapped to residue 1341 for RYR2.



RYR2VFSKTV-AGGLPGAGLFGPK-NDLEDYDAD>S<DFEVLMKTAHGHLVPDRVDKDKEATKPEFN1371
RYR1HFRCTAGATPLAPPGLQPPAEDEARAAEPD>P<DYENLRRSAGGWSEAENGKEGTAKEGAPGG1359
RYR3SFSH-------------------------->-<------------------------------1302
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1341Fc.4022C>T Putative BenignSIFT: deleterious
Polyphen: benign