Paralogue Annotation for RYR2 residue 1399

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1399
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1399

No paralogue variants have been mapped to residue 1399 for RYR2.



RYR2---DYAQEKP-SR--LKQRFLLRRTKPDYS>T<SHSARLTEDVLADDRDDYDFLMQT-STYYY1428
RYR1NEKDATTEKNKKRGFLFKAKKVAMMTQPPA>T<PTLPRLPHDVVPADNRDDPEIILNTTTYYY1434
RYR3------------------------------>-<--SPCLDSEAFQKRKQMQEILSHTTTQCYY1330
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T1399Kc.4196C>A Putative BenignSIFT: tolerated
Polyphen: benign