Paralogue Annotation for RYR2 residue 1400

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1400
Reference Amino Acid: S - Serine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1400

No paralogue variants have been mapped to residue 1400 for RYR2.



RYR2--DYAQEKP-SR--LKQRFLLRRTKPDYST>S<HSARLTEDVLADDRDDYDFLMQT-STYYYS1429
RYR1EKDATTEKNKKRGFLFKAKKVAMMTQPPAT>P<TLPRLPHDVVPADNRDDPEIILNTTTYYYS1435
RYR3------------------------------>-<-SPCLDSEAFQKRKQMQEILSHTTTQCYYA1331
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.S1400Gc.4198A>G Benignrs56229512SIFT: tolerated
Polyphen: possibly damaging