Paralogue Annotation for RYR2 residue 1431

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1431
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1431

No paralogue variants have been mapped to residue 1431 for RYR2.



RYR2SARLTEDVLADDRDDYDFLMQT-STYYYSV>R<IFPGQEPANVWVGWITSDFHQYDTGFDLDR1461
RYR1LPRLPHDVVPADNRDDPEIILNTTTYYYSV>R<VFAGQEPSCVWAGWVTPDYHQHDMSFDLSK1467
RYR3SPCLDSEAFQKRKQMQEILSHTTTQCYYAI>R<IFAGQDPSCVWVGWVTPDYHLYSEKFDLNK1363
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R1431Kc.4292G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging