Paralogue Annotation for RYR2 residue 1560

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1560
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1560

No paralogue variants have been mapped to residue 1560 for RYR2.



RYR2YYQVEPSTKLFPAVFAQATSPNVFQFELGR>I<KNVMPLSAGLFKSEHKNPVPQCPPRLHVQF1590
RYR1FFQVEPNTKLFPAVFVLPTHQNVIQFELGK>Q<KNIMPLSAAMFQSERKNPAPQCPPRLEMQM1598
RYR3CYQVEPNTKVFPAVFLQPTSTSLFQFELGK>L<KNAMPLSAAIFRSEEKNPVPQCPPRLDVQT1494
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I1560Tc.4679T>C Putative BenignSIFT: tolerated
Polyphen: possibly damaging