Paralogue Annotation for RYR2 residue 1564

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1564
Reference Amino Acid: M - Methionine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1564

No paralogue variants have been mapped to residue 1564 for RYR2.



RYR2EPSTKLFPAVFAQATSPNVFQFELGRIKNV>M<PLSAGLFKSEHKNPVPQCPPRLHVQFLSHV1594
RYR1EPNTKLFPAVFVLPTHQNVIQFELGKQKNI>M<PLSAAMFQSERKNPAPQCPPRLEMQMLMPV1602
RYR3EPNTKVFPAVFLQPTSTSLFQFELGKLKNA>M<PLSAAIFRSEEKNPVPQCPPRLDVQTIQPV1498
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M1564Ic.4692G>A Putative BenignSIFT: deleterious
Polyphen: possibly damaging