Paralogue Annotation for RYR2 residue 1565

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1565
Reference Amino Acid: P - Proline
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1565

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1P1573LNemaline myopathy High9 22407809

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2PSTKLFPAVFAQATSPNVFQFELGRIKNVM>P<LSAGLFKSEHKNPVPQCPPRLHVQFLSHVL1595
RYR1PNTKLFPAVFVLPTHQNVIQFELGKQKNIM>P<LSAAMFQSERKNPAPQCPPRLEMQMLMPVS1603
RYR3PNTKVFPAVFLQPTSTSLFQFELGKLKNAM>P<LSAAIFRSEEKNPVPQCPPRLDVQTIQPVL1499
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1565Ac.4693C>G CardiomyopathyARVD/CSIFT:
Polyphen:
ReportsCardiomyopathyARVD/C Incremental value of cardiac magnetic resonance imaging in arrhythmic risk stratification of arrhythmogenic right ventricular dysplasia/cardiomyopathy-associated desmosomal mutation carriers. J Am Coll Cardiol. 2013 62(19):1761-9. doi: 10.1016/j.jacc.2012.11.087. 23810894