Paralogue Annotation for RYR2 residue 1583

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1583
Reference Amino Acid: P - Proline
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1583

No paralogue variants have been mapped to residue 1583 for RYR2.



RYR2FQFELGRIKNVMPLSAGLFKSEHKNPVPQC>P<PRLHVQFLSHVLWSRMPNQFLKVDVSRISE1613
RYR1IQFELGKQKNIMPLSAAMFQSERKNPAPQC>P<PRLEMQMLMPVSWSRMPNHFLQVETRRAGE1621
RYR3FQFELGKLKNAMPLSAAIFRSEEKNPVPQC>P<PRLDVQTIQPVLWSRMPNSFLKVETERVSE1517
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1583Sc.4747C>T CardiomyopathySIFT: deleterious
Polyphen: probably damaging
ReportsCardiomyopathyARVD/C Prevalence and significance of rare RYR2 variants in arrhythmogenic right ventricular cardiomyopathy/dysplasia: results of a systematic screening. Heart Rhythm. 2014 11(11):1999-2009. doi: 10.1016/j.hrthm.2014.07.020 25041964