Paralogue Annotation for RYR2 residue 1584

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1584
Reference Amino Acid: P - Proline
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1584

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1P1592LMalignant hyperthermiaHigh9 16917943

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2QFELGRIKNVMPLSAGLFKSEHKNPVPQCP>P<RLHVQFLSHVLWSRMPNQFLKVDVSRISER1614
RYR1QFELGKQKNIMPLSAAMFQSERKNPAPQCP>P<RLEMQMLMPVSWSRMPNHFLQVETRRAGER1622
RYR3QFELGKLKNAMPLSAAIFRSEEKNPVPQCP>P<RLDVQTIQPVLWSRMPNSFLKVETERVSER1518
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1584Sc.4750C>T Putative BenignSIFT:
Polyphen:
p.P1584Lc.4751C>T Putative BenignSIFT:
Polyphen: