Paralogue Annotation for RYR2 residue 1617

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1617
Reference Amino Acid: W - Tryptophan
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1617

No paralogue variants have been mapped to residue 1617 for RYR2.



RYR2HVQFLSHVLWSRMPNQFLKVDVSRISERQG>W<LVQCLDPLQFMSLHIPEENRSVDILELTEQ1647
RYR1EMQMLMPVSWSRMPNHFLQVETRRAGERLG>W<AVQCQEPLTMMALHIPEENRCMDILELSER1655
RYR3DVQTIQPVLWSRMPNSFLKVETERVSERHG>W<VVQCLEPLQMMALHIPEENRCVDILELCEQ1551
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.W1617Cc.4851G>T Putative BenignSIFT: deleterious
Polyphen: probably damaging