Paralogue Annotation for RYR2 residue 165

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 165
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 165

No paralogue variants have been mapped to residue 165 for RYR2.



RYR2TSRSSTDKLAFDVGLQEDTTGEACWWTIHP>A<SKQRSEGEKVRVGDDLILVSVSSERYLHLS195
RYR1TSRSMTDKLAFDVGLQEDATGEACWWTMHP>A<SKQRSEGEKVRVGDDIILVSVSSERYLHLS182
RYR3TSRSQTDKLAFDVGLREHATGEACWWTIHP>A<SKQRSEGEKVRIGDDLILVSVSSERYLHLS185
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A165Dc.494C>A Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT The role of stress test for predicting genetic mutations and future cardiac events in asymptomatic relatives of catecholaminergic polymorphic ventricular tachycardia probands. Europace. 2012 14(9):1344-51. doi: 10.1093/europace/eus031. 22383456