Paralogue Annotation for RYR2 residue 1696

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1696
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1696

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1G1704SMyopathy, congenital with coresHigh9 18253926

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2ALGNHRVAHALCSHVDEPQLLYAIENKYMP>G<LLRAGYYDLLIDIHLSSYATARLMMNNEYI1726
RYR1ALGNNRVAHALCSHVDQAQLLHALEDAHLP>G<PLRAGYYDLLISIHLESACRSRRSMLSEYI1734
RYR3ALGNSRVAYALCSHVDLSQLFYAIDNKYLP>G<LLRSGFYDLLISIHLASAKERKLMMKNEYI1630
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 1696 for RYR2.