Paralogue Annotation for RYR2 residue 1720

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1720
Reference Amino Acid: M - Methionine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1720

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1S1728PMalignant hyperthermiaMedium6 15731587
RYR1S1728FMalignant hyperthermiaMedium6 16917943, 19648156, 24195946, 25637381

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2ENKYMPGLLRAGYYDLLIDIHLSSYATARL>M<MNNEYIVPMTEETKSITLFPD------ENK1744
RYR1EDAHLPGPLRAGYYDLLISIHLESACRSRR>S<MLSEYIVPLTPETRAITLFPPGRSTENGHP1758
RYR3DNKYLPGLLRSGFYDLLISIHLASAKERKL>M<MKNEYIIPITSTTRNIRLFPD------ESK1648
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M1720Vc.5158A>G Putative BenignSIFT:
Polyphen: