Paralogue Annotation for RYR2 residue 179

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 179
Reference Amino Acid: D - Aspartate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 179

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1D166GMalignant hyperthermiaHigh9 16917943
RYR1D166NMalignant hyperthermiaHigh9 12059893

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2LQEDTTGEACWWTIHPASKQRSEGEKVRVG>D<DLILVSVSSERYLHLSYGNGSLHVDAAFQQ209
RYR1LQEDATGEACWWTMHPASKQRSEGEKVRVG>D<DIILVSVSSERYLHLSTASGELQVDASFMQ196
RYR3LREHATGEACWWTIHPASKQRSEGEKVRIG>D<DLILVSVSSERYLHLSVSNGNIQVDASFMQ199
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Asp179Asnc.535G>A UnknownSIFT:
Polyphen: