Paralogue Annotation for RYR2 residue 1804

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1804
Reference Amino Acid: L - Leucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1804

No paralogue variants have been mapped to residue 1804 for RYR2.



RYR2ECYQYSPEFPLDILKSKTIQMLTEAVKEGS>L<HARDPVGGTTEFLFVPLIKLFYTLLIMGIF1834
RYR1APARLSPAIPLEALRDKALRMLGEAVRDGG>Q<HARDPVGGSVEFQFVPVLKLVSTLLVMGIF1854
RYR3DHQKQSPEIPLESLRTKALSMLTEAVQCSG>A<HIRDPVGGSVEFQFVPVLKLIGTLLVMGVF1738
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.L1804Fc.5410C>T Putative BenignSIFT: tolerated
Polyphen: benign