Paralogue Annotation for RYR2 residue 1857

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1857
Reference Amino Acid: P - Proline
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1857

No paralogue variants have been mapped to residue 1857 for RYR2.



RYR2TLLIMGIFHNEDLKHILQLIEPSVFKEAAT>P<EEESDTL--E-K---ELS----VDDAK-LQ1876
RYR1TLLVMGIFGDEDVKQILKMIEPEVFTEEEE>E<EDEEEEGEEEDEEEKEEDEEETAQEKEDEE1907
RYR3TLLVMGVFDDDDVRQILLLIDPSVFGEHSA>G<TEEGAEK--E-E---VTQ----VEEKA-VE1780
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P1857Lc.5570C>T Putative BenignSIFT: tolerated
Polyphen: benign