Paralogue Annotation for RYR2 residue 1884

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1884
Reference Amino Acid: K - Lysine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1884

No paralogue variants have been mapped to residue 1884 for RYR2.



RYR2E-K---ELS----VDDAK-LQGAGEE--EA>K<GGKRPKEGLLQMKLPEPVKLQMCLLLQYLC1914
RYR1EDEEEKEEDEEETAQEKEDEEKEEEEAAEG>E<KEEGLEEGLLQMKLPESVKLQMCHLLEYFC1947
RYR3E-E---VTQ----VEEKA-VEAG-----EK>A<GKEAPVKGLLQTRLPESVKLQMCELLSYLC1815
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K1884Nc.5652G>T Putative BenignSIFT: deleterious
Polyphen: benign