Paralogue Annotation for RYR2 residue 1934

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1934
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1934

No paralogue variants have been mapped to residue 1934 for RYR2.



RYR2LQMCLLLQYLCDCQVRHRIEAIVAFSDDFV>A<KLQDNQRFRYNEVMQALNMSAALTARKTKE1964
RYR1LQMCHLLEYFCDQELQHRVESLAAFAERYV>D<KLQANQRSRYGLLIKAFSMTAAETARRTRE1997
RYR3LQMCELLSYLCDCELQHRVEAIVAFGDIYV>S<KLQANQKFRYNELMQALNMSAALTARKTKE1865
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A1934Vc.5801C>T Putative BenignSIFT: tolerated
Polyphen: benign