Paralogue Annotation for RYR2 residue 1946

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1946
Reference Amino Acid: E - Glutamate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1946

No paralogue variants have been mapped to residue 1946 for RYR2.



RYR2CQVRHRIEAIVAFSDDFVAKLQDNQRFRYN>E<VMQALNMSAALTARKTKEFRSPPQEQINML1976
RYR1QELQHRVESLAAFAERYVDKLQANQRSRYG>L<LIKAFSMTAAETARRTREFRSPPQEQINML2009
RYR3CELQHRVEAIVAFGDIYVSKLQANQKFRYN>E<LMQALNMSAALTARKTKEFRSPPQEQINML1877
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.E1946Kc.5836G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging