Paralogue Annotation for RYR2 residue 1975

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 1975
Reference Amino Acid: M - Methionine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 1975

No paralogue variants have been mapped to residue 1975 for RYR2.



RYR2NEVMQALNMSAALTARKTKEFRSPPQEQIN>M<LLNFKD--DKSECPCPEEIRDQLLDFHEDL2003
RYR1GLLIKAFSMTAAETARRTREFRSPPQEQIN>M<LLQFKDGTDEEDCPLPEEIRQDLLDFHQDL2038
RYR3NELMQALNMSAALTARKTKEFRSPPQEQIN>M<LLNFQL--GE-NCPCPEEIREELYDFHEDL1903
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.M1975Vc.5923A>G Putative BenignSIFT: deleterious
Polyphen: benign