Paralogue Annotation for RYR2 residue 2075

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2075
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2075

No paralogue variants have been mapped to residue 2075 for RYR2.



RYR2EKPVESDSKKSSTLQQLISETMVRWAQESV>I<EDPELVRAMFVLLHRQYDGIGGLVRALPKT2105
RYR1EEERSAEESKPRSLQELVSHMVVRWAQEDF>V<QSPELVRAMFSLLHRQYDGLGELLRALPRA2141
RYR3EQPTEEEERCPTTLKELISQTMICWAQEDQ>I<QDSELVRMMFNLLRRQYDSIGELLQALRKT2003
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2075Tc.6224T>C Other Cardiac PhenotypeSIFT:
Polyphen:
ReportsOther Cardiac Phenotype Ryanodine Receptor Mutations Presenting as Idiopathic Ventricular Fibrillation: A Report on Two Novel Familial Compound Mutations, c.6224T>C and c.13781A>G, With the Clinical Presentation of Idiopathic Ventricular Fibrillation. Pediatr Cardiol. 2014 24950728