Paralogue Annotation for RYR2 residue 210

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 210
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 210

No paralogue variants have been mapped to residue 210 for RYR2.



RYR2DLILVSVSSERYLHLSYGNGSLHVDAAFQQ>T<LWSVAPISSGSEAAQGYLIGGDVLRLLHGH240
RYR1DIILVSVSSERYLHLSTASGELQVDASFMQ>T<LWNMNPICSR--CEEGFVTGGHVLRLFHGH225
RYR3DLILVSVSSERYLHLSVSNGNIQVDASFMQ>T<LWNVHPTCSGSSIEEGYLLGGHVVRLFHGH230
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T210Ic.629C>T Putative BenignSIFT: deleterious
Polyphen: possibly damaging