Paralogue Annotation for RYR2 residue 2153

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2153
Reference Amino Acid: K - Lysine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2153

No paralogue variants have been mapped to residue 2153 for RYR2.



RYR2LGQIRSLLSVRMGKEEEKLMIRGLGDIMNN>K<VFYQHPNLMRALGMHETVMEVMVNVLGGGE2183
RYR1LGQIRSLLIVQMGPQEENLMIQSIGNIMNN>K<VFYQHPNLMRALGMHETVMEVMVNVLGGGE2219
RYR3LGQIRSLLSVRMGKEEELLMINGLGDIMNN>K<VFYQHPNLMRVLGMHETVMEVMVNVLGT-E2080
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.K2153Ec.6457A>G Other Disease PhenotypeSIFT:
Polyphen:
ReportsOther Disease Phenotype Candidate colorectal cancer predisposing gene variants in Chinese early-onset and familial cases. World J Gastroenterol. 2015 21(14):4136-49. doi: 10.3748/wjg.v21.i14.4136. 25892863