Paralogue Annotation for RYR2 residue 2156

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2156
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2156

No paralogue variants have been mapped to residue 2156 for RYR2.



RYR2IRSLLSVRMGKEEEKLMIRGLGDIMNNKVF>Y<QHPNLMRALGMHETVMEVMVNVLGGGESKE2186
RYR1IRSLLIVQMGPQEENLMIQSIGNIMNNKVF>Y<QHPNLMRALGMHETVMEVMVNVLGGGESKE2222
RYR3IRSLLSVRMGKEEELLMINGLGDIMNNKVF>Y<QHPNLMRVLGMHETVMEVMVNVLGT-EKSQ2083
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y2156Cc.6467A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging
ReportsPutative Benign The RYR2-encoded ryanodine receptor/calcium release channel in patients diagnosed previously with either catecholaminergic polymorphic ventricular tachycardia or genotype negative, exercise-induced long QT syndrome: a comprehensive open reading frame mutational analysis. J Am Coll Cardiol. 2009 54(22):2065-74. 19926015