Paralogue Annotation for RYR2 residue 230

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 230
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 230

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1G215ECentral core diseaseHigh9 12937085, 23422674, 24319099

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2SLHVDAAFQQTLWSVAPISSGSEAAQGYLI>G<GDVLRLLHGHMDECLTVPSGEHGEEQRRTV260
RYR1ELQVDASFMQTLWNMNPICSR--CEEGFVT>G<GHVLRLFHGHMDECLTISPAD-SDDQRRLV244
RYR3NIQVDASFMQTLWNVHPTCSGSSIEEGYLL>G<GHVVRLFHGH-DECLTIPSTDQNDSQHRRI249
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G230Cc.688G>T Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT A novel ryanodine receptor mutation linked to sudden death increases sensitivity to cytosolic calcium. Circ Res. 2011 109(3):281-90. 21659649
Inherited ArrhythmiaCPVT The CPVT-associated RyR2 mutation G230C enhances store overload-induced Ca2+ release and destabilizes the N-terminal domains. Biochem J. 2013 454(1):123-31. doi: 10.1042/BJ20130594. 23746327
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
p.Gly230Aspc.689G>A UnknownSIFT:
Polyphen: