Paralogue Annotation for RYR2 residue 2326

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2326
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2326

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1R2359QMalignant hyperthermiaHigh9 24433488
RYR1R2359WMalignant hyperthermiaHigh9

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2ERYLDFLRFAVFCNGESVEENANVVVRLLI>R<RPECFGPALRGEGGNGLLAAMEEAIKIAED2356
RYR1ERYLDFLRFAVFVNGESVEENANVVVRLLI>R<KPECFGPALRGEGGSGLLAAIEEAIRISED2389
RYR3ERYLSFLRFAVFVNSESVEENASVVVKLLI>R<RPECFGPALRGEGGNGLLAAMQGAIKISEN2253
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2326Qc.6977G>A Putative BenignSIFT:
Polyphen: