Paralogue Annotation for RYR2 residue 2328

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2328
Reference Amino Acid: P - Proline
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2328

No paralogue variants have been mapped to residue 2328 for RYR2.



RYR2YLDFLRFAVFCNGESVEENANVVVRLLIRR>P<ECFGPALRGEGGNGLLAAMEEAIKIAEDPS2358
RYR1YLDFLRFAVFVNGESVEENANVVVRLLIRK>P<ECFGPALRGEGGSGLLAAIEEAIRISEDPA2391
RYR3YLSFLRFAVFVNSESVEENASVVVKLLIRR>P<ECFGPALRGEGGNGLLAAMQGAIKISENPA2255
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.P2328Sc.6982C>T Inherited ArrhythmiaCPVTSIFT: deleterious
Polyphen: probably damaging
ReportsInherited ArrhythmiaCPVT Mutations of the cardiac ryanodine receptor (RyR2) gene in familial polymorphic ventricular tachycardia. Circulation. 2001 103(4):485-90. 11157710
Inherited ArrhythmiaCPVT Sudden death in familial polymorphic ventricular tachycardia associated with calcium release channel (ryanodine receptor) leak. Circulation. 2004 109(25):3208-14. 15197150
Inherited ArrhythmiaCPVT New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
Inherited ArrhythmiaCPVT ATP interacts with the CPVT mutation-associated central domain of the cardiac ryanodine receptor. Biochim Biophys Acta. 2013 1830(10):4426-32. doi: 10.1016/j.bbagen.2013.05.03 23747301
p.Pro2328Leuc.6983C>T UnknownSIFT:
Polyphen: