Paralogue Annotation for RYR2 residue 2342

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2342
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2342

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1G2375AMalignant hyperthermiaHigh9 12434264, 15210166

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2SVEENANVVVRLLIRRPECFGPALRGEGGN>G<LLAAMEEAIKIAEDPSRDGPSPNS-GSSKT2371
RYR1SVEENANVVVRLLIRKPECFGPALRGEGGS>G<LLAAIEEAIRISEDPARDGPGIRRDRRREH2405
RYR3SVEENASVVVKLLIRRPECFGPALRGEGGN>G<LLAAMQGAIKISENPALDLPSQGY-KREVS2268
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G2342Rc.7024G>A Inherited ArrhythmiaCPVTSIFT:
Polyphen:
ReportsInherited ArrhythmiaCPVT Gender Differences in the Inheritance Mode of RYR2 Mutations in Catecholaminergic Polymorphic Ventricular Tachycardia Patients. PLoS One. 2015 10(6):e0131517. doi: 10.1371/journal.pone.0131517. 26114861
p.Gly2342Gluc.7025G>A UnknownSIFT:
Polyphen: