Paralogue Annotation for RYR2 residue 2353

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2353
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2353

No paralogue variants have been mapped to residue 2353 for RYR2.



RYR2LLIRRPECFGPALRGEGGNGLLAAMEEAIK>I<AEDPSRDGPSPNS-GSSKTLDTEEEEDDTI2382
RYR1LLIRKPECFGPALRGEGGSGLLAAIEEAIR>I<SEDPARDGPGIRRDRRREHFGEEPPEENRV2416
RYR3LLIRRPECFGPALRGEGGNGLLAAMQGAIK>I<SENPALDLPSQGY-KREVSTGDDEEEEEIV2279
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.I2353Vc.7057A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging