Paralogue Annotation for RYR2 residue 2360

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2360
Reference Amino Acid: D - Aspartate
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2360

No paralogue variants have been mapped to residue 2360 for RYR2.



RYR2CFGPALRGEGGNGLLAAMEEAIKIAEDPSR>D<GPSPNS-GSSKTLDTEEEEDDTIHMGNAIM2389
RYR1CFGPALRGEGGSGLLAAIEEAIRISEDPAR>D<GPGIRRDRRREHFGEEPPEENRVHLGHAIM2423
RYR3CFGPALRGEGGNGLLAAMQGAIKISENPAL>D<LPSQGY-KREVSTGDDEEEEEIVHMGNAIM2286
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.D2360Nc.7078G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging