Paralogue Annotation for RYR2 residue 2419

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2419
Reference Amino Acid: I - Isoleucine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2419

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1I2453TMalignant hyperthermiaHigh9 12434264, 14708096

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2MTFYSALIDLLGRCAPEMHLIHAGKGEAIR>I<RSILRSLIPLGDLVGVISIAFQMPTIAKDG2449
RYR1MSFYAALIDLLGRCAPEMHLIQAGKGEALR>I<RAILRSLVPLEDLVGIISLPLQIPTLGKDG2483
RYR3MSFYSALIDLLGRCAPEMHLIQTGKGEAIR>I<RSILRSLVPTEDLVGIISIPLKLPSLNKDG2346
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

There are currently no reported variants at residue 2419 for RYR2.