Paralogue Annotation for RYR2 residue 2439

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2439
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2439

No paralogue variants have been mapped to residue 2439 for RYR2.



RYR2IHAGKGEAIRIRSILRSLIPLGDLVGVISI>A<FQMPTIAKDGNVVEPDMSAGFCPDHKAAMV2469
RYR1IQAGKGEALRIRAILRSLVPLEDLVGIISL>P<LQIPTLGKDGALVQPKMSASFVPDHKASMV2503
RYR3IQTGKGEAIRIRSILRSLVPTEDLVGIISI>P<LKLPSLNKDGSVSEPDMAANFCPDHKAPMV2366
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A2439Tc.7315G>A CardiomyopathySIFT: deleterious
Polyphen: benign
ReportsCardiomyopathynsCM Next generation sequencing challenges in the analysis of cardiac sudden death due to arrhythmogenic disorders. Electrophoresis. 2014 35(21-22):3111-6. doi: 10.1002/elps.201400148. 24981977
p.A2439Gc.7316C>G Putative BenignSIFT: deleterious
Polyphen: benign