Paralogue Annotation for RYR2 residue 2441

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2441
Reference Amino Acid: Q - Glutamine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2441

No paralogue variants have been mapped to residue 2441 for RYR2.



RYR2AGKGEAIRIRSILRSLIPLGDLVGVISIAF>Q<MPTIAKDGNVVEPDMSAGFCPDHKAAMVLF2471
RYR1AGKGEALRIRAILRSLVPLEDLVGIISLPL>Q<IPTLGKDGALVQPKMSASFVPDHKASMVLF2505
RYR3TGKGEAIRIRSILRSLVPTEDLVGIISIPL>K<LPSLNKDGSVSEPDMAANFCPDHKAPMVLF2368
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Q2441Ec.7321C>G Putative BenignSIFT: tolerated
Polyphen: benign