Paralogue Annotation for RYR2 residue 2452

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2452
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2452

No paralogue variants have been mapped to residue 2452 for RYR2.



RYR2ILRSLIPLGDLVGVISIAFQMPTIAKDGNV>V<EPDMSAGFCPDHKAAMVLFLDRVYGIEVQD2482
RYR1ILRSLVPLEDLVGIISLPLQIPTLGKDGAL>V<QPKMSASFVPDHKASMVLFLDRVYGIENQD2516
RYR3ILRSLVPTEDLVGIISIPLKLPSLNKDGSV>S<EPDMAANFCPDHKAPMVLFLDRVYGIKDQT2379
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2452Mc.7354G>A Putative BenignSIFT: tolerated
Polyphen: benign