Paralogue Annotation for RYR2 residue 2461

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2461
Reference Amino Acid: C - Cysteine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2461

No paralogue variants have been mapped to residue 2461 for RYR2.



RYR2DLVGVISIAFQMPTIAKDGNVVEPDMSAGF>C<PDHKAAMVLFLDRVYGIEVQDFLLHLLEVG2491
RYR1DLVGIISLPLQIPTLGKDGALVQPKMSASF>V<PDHKASMVLFLDRVYGIENQDFLLHVLDVG2525
RYR3DLVGIISIPLKLPSLNKDGSVSEPDMAANF>C<PDHKAPMVLFLDRVYGIKDQTFLLHLLEVG2388
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.C2461Fc.7382G>T Putative BenignSIFT: deleterious
Polyphen: probably damaging