Paralogue Annotation for RYR2 residue 2499

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2499
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2499

No paralogue variants have been mapped to residue 2499 for RYR2.



RYR2VLFLDRVYGIEVQDFLLHLLEVGFLPDLRA>A<ASLDTAALSATDMALALNRYLCTAVLPLLT2529
RYR1VLFLDRVYGIENQDFLLHVLDVGFLPDMRA>A<ASLDTATFSTTEMALALNRYLCLAVLPLIT2563
RYR3VLFLDRVYGIKDQTFLLHLLEVGFLPDLRA>S<ASLDTVSLSTTEAALALNRYICSAVLPLLT2426
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A2499Tc.7495G>A Putative BenignSIFT: deleterious
Polyphen: probably damaging