Paralogue Annotation for RYR2 residue 250

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 250
Reference Amino Acid: G - Glycine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 250

No paralogue variants have been mapped to residue 250 for RYR2.



RYR2GSEAAQGYLIGGDVLRLLHGHMDECLTVPS>G<EHGEEQRRTVHYEGGAVSVHARSLWRLETL280
RYR1R--CEEGFVTGGHVLRLFHGHMDECLTISP>A<D-SDDQRRLVYYEGGAVCTHARSLWRLEPL264
RYR3GSSIEEGYLLGGHVVRLFHGH-DECLTIPS>T<DQNDSQHRRIFYEAGGAGTRARSLWRVEPL269
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.G250Vc.749G>T Putative BenignSIFT: tolerated
Polyphen: benign