Paralogue Annotation for RYR2 residue 2504

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2504
Reference Amino Acid: T - Threonine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2504

No paralogue variants have been mapped to residue 2504 for RYR2.



RYR2RVYGIEVQDFLLHLLEVGFLPDLRAAASLD>T<AALSATDMALALNRYLCTAVLPLLTRCAPL2534
RYR1RVYGIENQDFLLHVLDVGFLPDMRAAASLD>T<ATFSTTEMALALNRYLCLAVLPLITKCAPL2568
RYR3RVYGIKDQTFLLHLLEVGFLPDLRASASLD>T<VSLSTTEAALALNRYICSAVLPLLTRCAPL2431
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.T2504Mc.7511C>T CardiomyopathyARVD/CSIFT: deleterious
Polyphen: probably damaging
ReportsCardiomyopathyARVD/C Identification of mutations in the cardiac ryanodine receptor gene in families affected with arrhythmogenic right ventricular cardiomyopathy type 2 (ARVD2). Hum Mol Genet. 2001 10(3):189-94. 11159936
CardiomyopathyARVD/C Enhanced store overload-induced Ca2+ release and channel sensitivity to luminal Ca2+ activation are common defects of RyR2 mutations linked to ventricular tachycardia and sudden death. Circ Res. 2005 97(11):1173-81. 16239587
CardiomyopathyARVD/C Abnormal termination of Ca2+ release is a common defect of RyR2 mutations associated with cardiomyopathies. Circ Res. 2012 110(7):968-77. 22374134
CardiomyopathyARVD/C New exome data question the pathogenicity of genetic variants previously associated with catecholaminergic polymorphic ventricular tachycardia. Circ Cardiovasc Genet. 2013 6(5):481-9. doi: 10.1161/CIRCGENETICS.113.000118. 24025405
CardiomyopathyARVD/C RYR2 sequencing reveals novel missense mutations in a Kazakh idiopathic ventricular tachycardia study cohort. PLoS One. 2014 9(6):e101059. doi: 10.1371/journal.pone.0101059. e 24978818