Paralogue Annotation for RYR2 residue 2593

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2593
Reference Amino Acid: V - Valine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2593

ParalogueVariantAssociated DiseaseMapping QualityConsensusPubmed
RYR1V2627LMalignant hyperthermiaHigh9 16835904
RYR1V2627MMalignant hyperthermiaHigh9 24013571

To assess whether the paralogue annotation here confidently predicts that variation at this residue is pathogenic, it is important to check the reports in the Pubmed links above to ascertain that the mutations in these paralogues have been proved likely to be disease-causing. It is also important to check that the direction of effect of the variant in the paralogue is compatible with your observed phenotype in RYR2.



RYR2KAQRDSIEVCLLSICGQLRPSMMQHLLRRL>V<FDVPLLNEHAKMPLKLLTNHYERCWKYYCL2623
RYR1KAQRDVIEDCLMSLCRYIRPSMLQHLLRRL>V<FDVPILNEFAKMPLKLLTNHYERCWKYYCL2657
RYR3KAQRDTIEECLLAICNHLRPSMLQQLLRRL>V<FDVPQLNEYCKMPLKLLTNHYEQCWKYYCL2520
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.V2593Ic.7777G>A Putative BenignSIFT: tolerated
Polyphen: probably damaging