Paralogue Annotation for RYR2 residue 26

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 26
Reference Amino Acid: A - Alanine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 26

No paralogue variants have been mapped to residue 26 for RYR2.



RYR2MADGGE-GEDEIQFLRTDDEVVLQCT>A<TIHKEQQKLCLAAEGFGNRLCFLESTSNSK56
RYR1MGD-AE-GEDEVQFLRTDDEVVLQCS>A<TVLKEQLKLCLAAEGFGNRLCFLEPTSNAQ55
RYR3MAEGGEGGEDEIQFLRTEDEVVLQCI>A<TIHKEQRKFCLAAEGLGNRLCFLEPTSEAK57
cons                          > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.A26Tc.76G>A Putative BenignSIFT: tolerated
Polyphen: possibly damaging