Paralogue Annotation for RYR2 residue 2743

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2743
Reference Amino Acid: Y - Tyrosine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2743

No paralogue variants have been mapped to residue 2743 for RYR2.



RYR2IPEKLEYFINKYAEHSHDKWSMDKLANGWI>Y<GEIYSDSSKVQPLMKPYKLLSEKEKEIYRW2773
RYR1IPEKLDSFINKFAEYTHEKWAFDKIQNNWS>Y<GENIDEELKTHPMLRPYKTFSEKDKEIYRW2807
RYR3LPEKLEYIVTKYAEHSHDKWACDKSQSGWK>Y<GISLDENVKTHPLIRPFKTLTEKEKEIYRW2670
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.Y2743Cc.8228A>G Putative BenignSIFT: deleterious
Polyphen: probably damaging