Paralogue Annotation for RYR2 residue 2793

Residue details

Gene: RYR2
Reference Sequences: LRG: LRG_402, Ensembl variant: ENST00000366574 / ENSP00000355533
Amino Acid Position: 2793
Reference Amino Acid: R - Arginine
Protein Domain: Cytoplasmic region


Paralogue Variants mapped to RYR2 residue 2793

No paralogue variants have been mapped to residue 2793 for RYR2.



RYR2LSEKEKEIYRWPIKESLKTMLAWGWRIERT>R<EGDSMALYNRTRRISQTSQV--SVDAAHGY2821
RYR1FSEKDKEIYRWPIKESLKAMIAWEWTIEKA>R<EGEEEK--TEKKKTRKISQSAQTYDPREGY2855
RYR3LTEKEKEIYRWPARESLKTMLAVGWTVERT>K<EGEALVQQRENEKLRSVSQA--NQ--GNSY2716
cons                              > <                              

See full Alignment of Paralogues


Known Variants in RYR2

ProteinCDSDisease ClassificationDiseasedbSNP linksEffect Prediction
p.R2793Wc.8377C>T Putative BenignSIFT: deleterious
Polyphen: probably damaging
p.R2793Qc.8378G>A Putative BenignSIFT: tolerated
Polyphen: benign